PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00001.1.g05300.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 587aa    MW: 63162.7 Da    PI: 5.3356
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00001.1.g05300.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.31.3e-961825863374
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   +lLlecA+av+++d +++q+l++ l+elasp+gd  q+la+yf+++L arl++s++++ ++l++ ++++ +s +++  ++l
  Zjn_sc00001.1.g05300.1.am.mk 182 QLLLECARAVAARDSQRVQQLMWMLNELASPYGDLEQKLASYFLQGLFARLTSSGPRTLRTLAAASDRN-TSFDSTRRTTL 261
                                   79************************************************************9998874.44444444455 PP

                          GRAS  84 .fsevsPilkfshltaNqaIleavege.......ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.. 153
                                    f+e+sP+  f+h++aN aIle++ ++       +r Hi+D++ + ++QWp+Ll+aLa+R+ +++p+l iT+v+s++++  
  Zjn_sc00001.1.g05300.1.am.mk 262 rFQELSPWSSFGHVAANGAILESFLEAaaassepQRFHILDLSNTFCTQWPTLLEALATRSaDDTPHLSITTVVSAAPSap 342
                                   6*********************987766667778999************************889***********988889 PP

                          GRAS 154 ...skeeleetgerLakfAeelgvpfefnvlvak.rledleleeLrvkp...gEalaVnlvlqlhrlldesvsleserdev 227
                                       ++ ++e+g+r++kfA+ +gvpf+f+++++  +l++l+l++L+++      alaVn++ +l  ++  ++     rd++
  Zjn_sc00001.1.g05300.1.am.mk 343 taaVQRVMREIGQRMEKFARLMGVPFSFQAVHHAgDLAELDLDALDLRDggaTTALAVNCINSLRGVV--PGGALR-RDAF 420
                                   999999************************97767**************888889************9..444444.7*** PP

                          GRAS 228 LklvkslsPkvvvvveqeadh.nse.............sFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                                      +++l+P+vv+vve+ead+   +              Fl+ f+e l+++sa +dsle+++p++s+er  +Er+  gr i
  Zjn_sc00001.1.g05300.1.am.mk 421 AASLRRLEPRVVTVVEEEADLvA-SdgassaeggdseaAFLKVFSEGLRFFSAYMDSLEESFPKTSNERLALERA-AGRVI 499
                                   *******************9954.447999*********************************************.***** PP

                          GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee........sgslvlgWkdrpL 367
                                   v++v+c  +e+ er+et+++W +r+++aGF+pv++se++a+++++llr++  +g+++ e            ++l Wk++p+
  Zjn_sc00001.1.g05300.1.am.mk 500 VDLVSCPASESMERRETAASWARRMRSAGFSPVAFSEDVADDVRSLLRRYR-EGWSMREAsiddsaagATGVFLAWKEQPV 579
                                   **************************************************9.888888666777777667788******** PP

                          GRAS 368 vsvSaWr 374
                                   v++SaWr
  Zjn_sc00001.1.g05300.1.am.mk 580 VWASAWR 586
                                   ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.9154559IPR005202Transcription factor GRAS
PfamPF035144.7E-94182586IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MDTLFRLVSL QATEQQQQSP SYNSRSTTSS GSWSSSHQTN ASYNYYYHST SSGGGGGGQY  60
YYGQHQHQQY YLEPYHEECG NANHLYMDED FSSSSSSRQH FHSHGGTVQP PTSSAATPTA  120
PTPPLSTSST AAGAAHALFE AADLSYPPDL NLDFSSPASS SGGGGASSAA VGGGAGGRWG  180
SQLLLECARA VAARDSQRVQ QLMWMLNELA SPYGDLEQKL ASYFLQGLFA RLTSSGPRTL  240
RTLAAASDRN TSFDSTRRTT LRFQELSPWS SFGHVAANGA ILESFLEAAA ASSEPQRFHI  300
LDLSNTFCTQ WPTLLEALAT RSADDTPHLS ITTVVSAAPS APTAAVQRVM REIGQRMEKF  360
ARLMGVPFSF QAVHHAGDLA ELDLDALDLR DGGATTALAV NCINSLRGVV PGGALRRDAF  420
AASLRRLEPR VVTVVEEEAD LVASDGASSA EGGDSEAAFL KVFSEGLRFF SAYMDSLEES  480
FPKTSNERLA LERAAGRVIV DLVSCPASES MERRETAASW ARRMRSAGFS PVAFSEDVAD  540
DVRSLLRRYR EGWSMREASI DDSAAGATGV FLAWKEQPVV WASAWRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-181825866375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0673280.0BT067328.1 Zea mays full-length cDNA clone ZM_BFc0012E13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008670524.10.0PREDICTED: protein SHORT-ROOT 1-like
SwissprotQ8H2X80.0SHR1_ORYSJ; Protein SHORT-ROOT 1
TrEMBLF2E4A50.0F2E4A5_HORVD; Predicted protein
STRINGMLOC_62665.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35263781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-138GRAS family protein